Lineage for d5xjtb_ (5xjt B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2396392Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2396611Protein D2 core SNRNP protein [50186] (3 species)
    3jb9 chains G and l are D2 subunits from fission yeast; not included because sids are not case sensitive
  7. 2396612Species Human (Homo sapiens) [TaxId:9606] [50187] (11 PDB entries)
  8. 2396633Domain d5xjtb_: 5xjt B: [354428]
    Other proteins in same PDB: d5xjta_, d5xjte_, d5xjtf_, d5xjtg_
    automated match to d1vu2b_

Details for d5xjtb_

PDB Entry: 5xjt (more details), 2.92 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2 in complex with smd1(1-82)/d2.r61a/f/e/g from human
PDB Compounds: (B:) Small nuclear ribonucleoprotein Sm D2

SCOPe Domain Sequences for d5xjtb_:

Sequence, based on SEQRES records: (download)

>d5xjtb_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
qkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdahcnmvlenvkemwte
vpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliag

Sequence, based on observed residues (ATOM records): (download)

>d5xjtb_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
qkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdahcnmvlenvkemwte
vkpvnkdryiskmflrgdsvivvlrnpliag

SCOPe Domain Coordinates for d5xjtb_:

Click to download the PDB-style file with coordinates for d5xjtb_.
(The format of our PDB-style files is described here.)

Timeline for d5xjtb_: