SCOP 1.59: Domain d1c4gb2: 1c4g B:191-303

Lineage for d1c4gb2 (1c4g B:191-303)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)

4. Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family)

5. Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)

6. Protein Phosphoglucomutase [53740] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries)

8. Domain d1c4gb2: 1c4g B:191-303 [35442]
   Other proteins in same PDB: d1c4ga4, d1c4gb4

Details for d1c4gb2

PDB Entry: 1c4g, 2.7 Å

PDB Description: phosphoglucomutase vanadate based transition state analog complex

SCOP Domain Sequences for d1c4gb2:

Sequence; same for both SEQRES and ATOM records:

>d1c4gb2 c.84.1.1 (B:191-303) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus)}
veayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv

Timeline for d1c4gb2:

• d1c4gb2 first appeared (with stable ids) in SCOP 1.55
  
• d1c4gb2 appears in SCOP 1.57
  
• d1c4gb2 appears in SCOP 1.61
  
• d1c4gb2 appears in the current release, SCOPe 2.08