Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) |
Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (1 protein) |
Protein Phosphoglucomutase, first 3 domains [53740] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries) |
Domain d1c4gb2: 1c4g B:191-303 [35442] Other proteins in same PDB: d1c4ga4, d1c4gb4 |
PDB Entry: 1c4g (more details), 2.7 Å
SCOP Domain Sequences for d1c4gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c4gb2 c.84.1.1 (B:191-303) Phosphoglucomutase, first 3 domains {Rabbit (Oryctolagus cuniculus)} veayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv
Timeline for d1c4gb2:
View in 3D Domains from other chains: (mouse over for more information) d1c4ga1, d1c4ga2, d1c4ga3, d1c4ga4 |