SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1lxtb3 (1lxt B:304-420)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141779Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2141780Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2141781Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 protein domains)
  6. 2141796Protein Phosphoglucomutase [53740] (1 species)
  7. 2141797Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries)
  8. 2141827Domain d1lxtb3: 1lxt B:304-420 [35437]
    Other proteins in same PDB: d1lxta4, d1lxtb4
    complexed with cd, so4

Details for d1lxtb3

PDB Entry: 1lxt (more details), 2.7 Å

PDB Description: structure of phosphotransferase phosphoglucomutase from rabbit
PDB Compounds: (B:) phosphoglucomutase (dephospho form)

SCOPe Domain Sequences for d1lxtb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxtb3 c.84.1.1 (B:304-420) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkffgn
lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg

SCOPe Domain Coordinates for d1lxtb3:

Click to download the PDB-style file with coordinates for d1lxtb3.
(The format of our PDB-style files is described here.)

Timeline for d1lxtb3: