Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) |
Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins) |
Domain d1lxtb3: 1lxt B:304-420 [35437] Other proteins in same PDB: d1lxta1, d1lxta4, d1lxtb1, d1lxtb4 complexed with cd, so4 |
PDB Entry: 1lxt (more details), 2.7 Å
SCOPe Domain Sequences for d1lxtb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lxtb3 c.84.1.1 (B:304-420) Phosphoglucomutase, middle and C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkffgn lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
Timeline for d1lxtb3:
View in 3D Domains from other chains: (mouse over for more information) d1lxta1, d1lxta2, d1lxta3, d1lxta4 |