Lineage for d1lxtb1 (1lxt B:1-190)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910122Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2910123Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2910124Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins)
  6. 2910167Protein Phosphoglucomutase, N-terminal domain [419006] (1 species)
  7. 2910168Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [419478] (6 PDB entries)
  8. 2910174Domain d1lxtb1: 1lxt B:1-190 [35435]
    Other proteins in same PDB: d1lxta2, d1lxta3, d1lxta4, d1lxtb2, d1lxtb3, d1lxtb4
    complexed with cd, so4
    has additional insertions and/or extensions that are not grouped together

Details for d1lxtb1

PDB Entry: 1lxt (more details), 2.7 Å

PDB Description: structure of phosphotransferase phosphoglucomutase from rabbit
PDB Compounds: (B:) phosphoglucomutase (dephospho form)

SCOPe Domain Sequences for d1lxtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxtb1 c.84.1.1 (B:1-190) Phosphoglucomutase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg
dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf
kpftveivds

SCOPe Domain Coordinates for d1lxtb1:

Click to download the PDB-style file with coordinates for d1lxtb1.
(The format of our PDB-style files is described here.)

Timeline for d1lxtb1: