SCOPe 2.08: Domain d5xkec1: 5xke C:1-245

Lineage for d5xkec1 (5xke C:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries)

8. Domain d5xkec1: 5xke C:1-245 [354352]
   Other proteins in same PDB: d5xkea2, d5xkeb2, d5xkec2, d5xked2, d5xkee_, d5xkef1, d5xkef2, d5xkef3
   automated match to d5fnva1
   complexed with ca, gdp, gol, gtp, lon, mes, mg

Details for d5xkec1

PDB Entry: 5xke, 2.6 Å

PDB Description: crystal structure of t2r-ttl-demecolcine complex

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5xkec1:

Sequence; same for both SEQRES and ATOM records:

>d5xkec1 c.32.1.1 (C:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d5xkec1:

• d5xkec1 first appeared in SCOPe 2.07