Lineage for d5xkec2 (5xke C:246-440)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525532Species Cow (Bos taurus) [TaxId:9913] [226565] (65 PDB entries)
  8. 3054291Domain d5xkec2: 5xke C:246-440 [354353]
    Other proteins in same PDB: d5xkea1, d5xkeb1, d5xkec1, d5xked1, d5xkee_, d5xkef1, d5xkef2, d5xkef3
    automated match to d4i50a2
    complexed with ca, gdp, gol, gtp, lon, mes, mg

Details for d5xkec2

PDB Entry: 5xke (more details), 2.6 Å

PDB Description: crystal structure of t2r-ttl-demecolcine complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5xkec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xkec2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5xkec2:

Click to download the PDB-style file with coordinates for d5xkec2.
(The format of our PDB-style files is described here.)

Timeline for d5xkec2:

  • d5xkec2 appears in periodic updates to SCOPe 2.07 starting on 2018-07-05