Lineage for d5xkee_ (5xke E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339704Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2339705Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2339706Protein Stathmin 4 [101496] (2 species)
  7. 2339707Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (97 PDB entries)
  8. 3054378Domain d5xkee_: 5xke E: [354440]
    Other proteins in same PDB: d5xkea1, d5xkea2, d5xkeb1, d5xkeb2, d5xkec1, d5xkec2, d5xked1, d5xked2, d5xkef1, d5xkef2, d5xkef3
    automated match to d4i55e_
    complexed with ca, gdp, gol, gtp, lon, mes, mg

Details for d5xkee_

PDB Entry: 5xke (more details), 2.6 Å

PDB Description: crystal structure of t2r-ttl-demecolcine complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5xkee_:

Sequence, based on SEQRES records: (download)

>d5xkee_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5xkee_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d5xkee_:

Click to download the PDB-style file with coordinates for d5xkee_.
(The format of our PDB-style files is described here.)

Timeline for d5xkee_:

  • d5xkee_ appears in periodic updates to SCOPe 2.07 starting on 2018-07-05