Lineage for d5xjuf_ (5xju F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787534Species Human (Homo sapiens) [TaxId:9606] [196227] (10 PDB entries)
  8. 2787539Domain d5xjuf_: 5xju F: [354336]
    Other proteins in same PDB: d5xjua_, d5xjub_
    automated match to d4f7ui_

Details for d5xjuf_

PDB Entry: 5xju (more details), 2.58 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2dn39 in complex with smd1(1-82)/d2.r61a/f/e/g from human
PDB Compounds: (F:) Small nuclear ribonucleoprotein F

SCOPe Domain Sequences for d5xjuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xjuf_ b.38.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgev
lircnnvlyirgve

SCOPe Domain Coordinates for d5xjuf_:

Click to download the PDB-style file with coordinates for d5xjuf_.
(The format of our PDB-style files is described here.)

Timeline for d5xjuf_: