SCOPe 2.08: Domain d5xjug_: 5xju G:

Lineage for d5xjug_ (5xju G:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.0: automated matches [191538] (1 protein)
   not a true family

6. Protein automated matches [190914] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196227] (10 PDB entries)

8. Domain d5xjug_: 5xju G: [354319]
   Other proteins in same PDB: d5xjua_, d5xjub_
   automated match to d3jb9j_

Details for d5xjug_

PDB Entry: 5xju, 2.58 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2dn39 in complex with smd1(1-82)/d2.r61a/f/e/g from human

PDB Compounds: (G:) Small nuclear ribonucleoprotein G

SCOPe Domain Sequences for d5xjug_:

Sequence, based on SEQRES records:

>d5xjug_ b.38.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirgnsiim
lea

Sequence, based on observed residues (ATOM records):

>d5xjug_ b.38.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkfmdkklslklnggrhvqgilrgfdpfmnlvidecvemagqqnnigmvvirgnsiimle
a

Timeline for d5xjug_:

• d5xjug_ first appeared in SCOPe 2.07