Lineage for d5xjug_ (5xju G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2397050Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2397051Protein automated matches [190914] (14 species)
    not a true protein
  7. 2397156Species Human (Homo sapiens) [TaxId:9606] [196227] (11 PDB entries)
  8. 2397165Domain d5xjug_: 5xju G: [354319]
    Other proteins in same PDB: d5xjua_, d5xjub_
    automated match to d3jb9j_

Details for d5xjug_

PDB Entry: 5xju (more details), 2.58 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2dn39 in complex with smd1(1-82)/d2.r61a/f/e/g from human
PDB Compounds: (G:) Small nuclear ribonucleoprotein G

SCOPe Domain Sequences for d5xjug_:

Sequence, based on SEQRES records: (download)

>d5xjug_ b.38.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirgnsiim
lea

Sequence, based on observed residues (ATOM records): (download)

>d5xjug_ b.38.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkfmdkklslklnggrhvqgilrgfdpfmnlvidecvemagqqnnigmvvirgnsiimle
a

SCOPe Domain Coordinates for d5xjug_:

Click to download the PDB-style file with coordinates for d5xjug_.
(The format of our PDB-style files is described here.)

Timeline for d5xjug_: