Lineage for d5zbld_ (5zbl D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922906Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2922907Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) (S)
  5. 2922991Family c.129.1.0: automated matches [233357] (1 protein)
    not a true family
  6. 2922992Protein automated matches [233358] (8 species)
    not a true protein
  7. 2922997Species Corynebacterium glutamicum [TaxId:196627] [321750] (2 PDB entries)
  8. 2923001Domain d5zbld_: 5zbl D: [354063]
    Other proteins in same PDB: d5zblb2
    automated match to d5itsc_
    complexed with amp, edo, gol, po4, so4

Details for d5zbld_

PDB Entry: 5zbl (more details), 2.3 Å

PDB Description: crystal structure of type-i log from corynebacterium glutamicum in complex with amp
PDB Compounds: (D:) Cytokinin riboside 5'-monophosphate phosphoribohydrolase

SCOPe Domain Sequences for d5zbld_:

Sequence, based on SEQRES records: (download)

>d5zbld_ c.129.1.0 (D:) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
tlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivadaflesgge
afgviteslmkgelgheklteleivpdmhirkrrmaelgdgfiampggagtleelfevwt
wqqlgihqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdphallkamqtw
tp

Sequence, based on observed residues (ATOM records): (download)

>d5zbld_ c.129.1.0 (D:) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
tlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivadaflesgge
afgviteslmkglgheklteleivpdmhirkrrmaelgdgfiampggagtleelfevwtw
qqlgihqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdphallkamqtwt
p

SCOPe Domain Coordinates for d5zbld_:

Click to download the PDB-style file with coordinates for d5zbld_.
(The format of our PDB-style files is described here.)

Timeline for d5zbld_: