SCOPe 2.08: Domain d5zblb1: 5zbl B:8-195

Lineage for d5zblb1 (5zbl B:8-195)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567

4. Superfamily c.129.1: MCP/YpsA-like [102405] (6 families)

5. Family c.129.1.0: automated matches [233357] (1 protein)
   not a true family

6. Protein automated matches [233358] (8 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:196627] [321750] (2 PDB entries)

8. Domain d5zblb1: 5zbl B:8-195 [354079]
   Other proteins in same PDB: d5zblb2
   automated match to d5itsc_
   complexed with amp, edo, gol, po4, so4

Details for d5zblb1

PDB Entry: 5zbl, 2.3 Å

PDB Description: crystal structure of type-i log from corynebacterium glutamicum in complex with amp

PDB Compounds: (B:) Cytokinin riboside 5'-monophosphate phosphoribohydrolase

SCOPe Domain Sequences for d5zblb1:

Sequence, based on SEQRES records:

>d5zblb1 c.129.1.0 (B:8-195) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
ptlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivadaflesgg
eafgviteslmkgelgheklteleivpdmhirkrrmaelgdgfiampggagtleelfevw
twqqlgihqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdphallkamqt
wtppapkw

Sequence, based on observed residues (ATOM records):

>d5zblb1 c.129.1.0 (B:8-195) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
ptlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivadaflesgg
eafgviteslmkgelgheklteleivpdmhirkrrmaelgdgfiampggagtleelfevw
twqqlgqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdphallkamqtwt
ppapkw

Timeline for d5zblb1:

• d5zblb1 first appeared in SCOPe 2.07