PDB entry 5zbl

View 5zbl on RCSB PDB site
Description: Crystal strcuture of type-I LOG from Corynebacterium glutamicum in complex with AMP
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-02-12, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytokinin riboside 5'-monophosphate phosphoribohydrolase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: Cg2612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zbla_
  • Chain 'B':
    Compound: Cytokinin riboside 5'-monophosphate phosphoribohydrolase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: Cg2612
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NN34 (Start-194)
      • expression tag (195)
    Domains in SCOPe 2.07: d5zblb1, d5zblb2
  • Chain 'C':
    Compound: Cytokinin riboside 5'-monophosphate phosphoribohydrolase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: Cg2612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zblc_
  • Chain 'D':
    Compound: Cytokinin riboside 5'-monophosphate phosphoribohydrolase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: Cg2612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zbld_
  • Heterogens: EDO, GOL, PO4, SO4, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zblA (A:)
    mtslfdaptlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivad
    aflesggeafgviteslmkgelgheklteleivpdmhirkrrmaelgdgfiampggagtl
    eelfevwtwqqlgihqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdpha
    llkamqtwtppapkwlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zblA (A:)
    tslfdaptlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivada
    flesggeafgviteslmkgelgheklteleivpdmhirkrrmaelgdgfiampggagtle
    elfevwtwqqlgihqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdphal
    lkamqtwtp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zblB (B:)
    mtslfdaptlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivad
    aflesggeafgviteslmkgelgheklteleivpdmhirkrrmaelgdgfiampggagtl
    eelfevwtwqqlgihqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdpha
    llkamqtwtppapkwlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zblB (B:)
    ptlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivadaflesgg
    eafgviteslmkgelgheklteleivpdmhirkrrmaelgdgfiampggagtleelfevw
    twqqlgqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdphallkamqtwt
    ppapkwl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zblC (C:)
    mtslfdaptlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivad
    aflesggeafgviteslmkgelgheklteleivpdmhirkrrmaelgdgfiampggagtl
    eelfevwtwqqlgihqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdpha
    llkamqtwtppapkwlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zblC (C:)
    tlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivadaflesgge
    afgvitesgheklteleivpdmhirkrrmaelgdgfiampggagtleelfevwtwqqlgi
    hqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdphallkamqtwtp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zblD (D:)
    mtslfdaptlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivad
    aflesggeafgviteslmkgelgheklteleivpdmhirkrrmaelgdgfiampggagtl
    eelfevwtwqqlgihqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdpha
    llkamqtwtppapkwlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zblD (D:)
    tlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivadaflesgge
    afgviteslmkglgheklteleivpdmhirkrrmaelgdgfiampggagtleelfevwtw
    qqlgihqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdphallkamqtwt
    p