Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries) |
Domain d6bryb2: 6bry B:244-428 [353959] Other proteins in same PDB: d6brya1, d6bryb1, d6bryc1, d6bryd1, d6brye_, d6bryf1, d6bryf2, d6bryf3 automated match to d3rycd2 complexed with acp, ca, gdp, gk9, gtp, mes, mg |
PDB Entry: 6bry (more details), 2.7 Å
SCOPe Domain Sequences for d6bryb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bryb2 d.79.2.1 (B:244-428) automated matches {Pig (Sus scrofa) [TaxId: 9823]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqda
Timeline for d6bryb2: