Lineage for d6bryb2 (6bry B:244-428)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959756Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)
  8. 2959919Domain d6bryb2: 6bry B:244-428 [353959]
    Other proteins in same PDB: d6brya1, d6bryb1, d6bryc1, d6bryd1, d6brye_, d6bryf1, d6bryf2, d6bryf3
    automated match to d3rycd2
    complexed with acp, ca, gdp, gk9, gtp, mes, mg

Details for d6bryb2

PDB Entry: 6bry (more details), 2.7 Å

PDB Description: tubulin-rb3_sld-ttl in complex with heterocyclic pyrimidine compound 6a
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6bryb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bryb2 d.79.2.1 (B:244-428) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

SCOPe Domain Coordinates for d6bryb2:

Click to download the PDB-style file with coordinates for d6bryb2.
(The format of our PDB-style files is described here.)

Timeline for d6bryb2: