SCOPe 2.08: Domain d6brye_: 6bry E:

Lineage for d6brye_ (6bry E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [353877] (8 PDB entries)

8. Domain d6brye_: 6bry E: [353878]
   Other proteins in same PDB: d6brya1, d6brya2, d6bryb1, d6bryb2, d6bryc1, d6bryc2, d6bryd1, d6bryd2, d6bryf1, d6bryf2, d6bryf3
   automated match to d4i55e_
   complexed with acp, ca, gdp, gk9, gtp, mes, mg

Details for d6brye_

PDB Entry: 6bry, 2.7 Å

PDB Description: tubulin-rb3_sld-ttl in complex with heterocyclic pyrimidine compound 6a

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6brye_:

Sequence, based on SEQRES records:

>d6brye_ a.137.10.1 (E:) Stathmin 4 {Human (Homo sapiens) [TaxId: 9606]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records):

>d6brye_ a.137.10.1 (E:) Stathmin 4 {Human (Homo sapiens) [TaxId: 9606]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

Timeline for d6brye_:

• d6brye_ first appeared in SCOPe 2.07