Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
Superfamily f.4.3: Porins [56935] (5 families) |
Family f.4.3.0: automated matches [267625] (1 protein) not a true family |
Protein automated matches [267676] (11 species) not a true protein |
Species Klebsiella aerogenes [TaxId:548] [353953] (1 PDB entry) |
Domain d5o9cd_: 5o9c D: [353954] automated match to d4d65a_ complexed with c8e |
PDB Entry: 5o9c (more details), 2.47 Å
SCOPe Domain Sequences for d5o9cd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o9cd_ f.4.3.0 (D:) automated matches {Klebsiella aerogenes [TaxId: 548]} dgnkldlygkidglhyfssddsvdgdqtymrigvkgetqindqltgygqweynvqannte sssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdnflqsra ngvatyrnsdffglvdglnfalqyqgkngsvsgedqtnngrdfqkqngegfgtsvtydiw dgisagfayssskrtdeqnnstfvsktdggrygvlgegdhaetytgglkydanniylatq ytqtynatrtgnigfankaqnfevvaqyqfdfglrpsvaylqskgkdmgrygdqdilkyv dlgatyyfnknmstyvdykinllddnkftkdasistdnvvalglvyqf
Timeline for d5o9cd_: