Lineage for d5o9cd_ (5o9c D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3022096Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 3022367Family f.4.3.0: automated matches [267625] (1 protein)
    not a true family
  6. 3022368Protein automated matches [267676] (11 species)
    not a true protein
  7. 3022387Species Klebsiella aerogenes [TaxId:548] [353953] (1 PDB entry)
  8. 3022391Domain d5o9cd_: 5o9c D: [353954]
    automated match to d4d65a_
    complexed with c8e

Details for d5o9cd_

PDB Entry: 5o9c (more details), 2.47 Å

PDB Description: crystal structure of omp36 from enterobacter aerogenes
PDB Compounds: (D:) Osmoporin Omp36

SCOPe Domain Sequences for d5o9cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o9cd_ f.4.3.0 (D:) automated matches {Klebsiella aerogenes [TaxId: 548]}
dgnkldlygkidglhyfssddsvdgdqtymrigvkgetqindqltgygqweynvqannte
sssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdnflqsra
ngvatyrnsdffglvdglnfalqyqgkngsvsgedqtnngrdfqkqngegfgtsvtydiw
dgisagfayssskrtdeqnnstfvsktdggrygvlgegdhaetytgglkydanniylatq
ytqtynatrtgnigfankaqnfevvaqyqfdfglrpsvaylqskgkdmgrygdqdilkyv
dlgatyyfnknmstyvdykinllddnkftkdasistdnvvalglvyqf

SCOPe Domain Coordinates for d5o9cd_:

Click to download the PDB-style file with coordinates for d5o9cd_.
(The format of our PDB-style files is described here.)

Timeline for d5o9cd_: