Lineage for d5o3za_ (5o3z A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846763Species Erwinia amylovora [TaxId:665029] [353492] (1 PDB entry)
  8. 2846764Domain d5o3za_: 5o3z A: [353539]
    automated match to d5jc8a_
    complexed with cl

Details for d5o3za_

PDB Entry: 5o3z (more details), 1.84 Å

PDB Description: crystal structure of sorbitol-6-phosphate 2-dehydrogenase srld from erwinia amylovora
PDB Compounds: (A:) Sorbitol-6-phosphate dehydrogenase

SCOPe Domain Sequences for d5o3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o3za_ c.2.1.0 (A:) automated matches {Erwinia amylovora [TaxId: 665029]}
eqvavvigggqtlgaflceglaqagyhvavadlnesnanrladtinsrygagraygfkvd
atdeasvealaravdetfgradllvysagvakaapitqfrltdfdlslqvnlvgyflcsr
efsklmirdgikgriiqinsksgkvgskhnsgysaakfggvgltqslaldlaeygitvhs
lmlgnllkspmfqsllpqyaeklgitpeevepyyvdkvplkrgcdyqdvlnvllfyasdk
aayctgqsinvtggqvmf

SCOPe Domain Coordinates for d5o3za_:

Click to download the PDB-style file with coordinates for d5o3za_.
(The format of our PDB-style files is described here.)

Timeline for d5o3za_: