Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Erwinia amylovora [TaxId:665029] [353492] (1 PDB entry) |
Domain d5o3zi_: 5o3z I: [353542] automated match to d5jc8a_ complexed with cl |
PDB Entry: 5o3z (more details), 1.84 Å
SCOPe Domain Sequences for d5o3zi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o3zi_ c.2.1.0 (I:) automated matches {Erwinia amylovora [TaxId: 665029]} eqvavvigggqtlgaflceglaqagyhvavadlnesnanrladtinsrygagraygfkvd atdeasvealaravdetfgradllvysagvakaapitqfrltdfdlslqvnlvgyflcsr efsklmirdgikgriiqinsksgkvgskhnsgysaakfggvgltqslaldlaeygitvhs lmlgnllkspmfqsllpqyaeklgitpeevepyyvdkvplkrgcdyqdvlnvllfyasdk aayctgqsinvtggqvmf
Timeline for d5o3zi_: