Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
Protein automated matches [190558] (13 species) not a true protein |
Species Ixodes ricinus [TaxId:34613] [353509] (2 PDB entries) |
Domain d5o46b_: 5o46 B: [353513] automated match to d3lh4a_ complexed with gol |
PDB Entry: 5o46 (more details), 1.76 Å
SCOPe Domain Sequences for d5o46b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o46b_ d.17.1.0 (B:) automated matches {Ixodes ricinus [TaxId: 34613]} fpgvwrkhhpdvdprykewahfaissqvenrtnfdtlmtlisvesqviagvdyklkmkva estcvigvdsyskercylkvnvpymlctavvnympwehktilksydcsdrvygv
Timeline for d5o46b_: