Lineage for d5o46a_ (5o46 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2542784Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2542960Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2542961Protein automated matches [190558] (13 species)
    not a true protein
  7. 2542998Species Ixodes ricinus [TaxId:34613] [353509] (2 PDB entries)
  8. 2543001Domain d5o46a_: 5o46 A: [353510]
    automated match to d3lh4a_
    complexed with gol

Details for d5o46a_

PDB Entry: 5o46 (more details), 1.76 Å

PDB Description: crystal structure of iristatin, a secreted salivary cystatin from the hard tick ixodes ricinus
PDB Compounds: (A:) Iristatin

SCOPe Domain Sequences for d5o46a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o46a_ d.17.1.0 (A:) automated matches {Ixodes ricinus [TaxId: 34613]}
fpgvwrkhhpdvdprykewahfaissqvenrtnfdtlmtlisvesqviagvdyklkmkva
estcvigvdsyskercylkvnvpymlctavvnympwehktilksydcsdrvygv

SCOPe Domain Coordinates for d5o46a_:

Click to download the PDB-style file with coordinates for d5o46a_.
(The format of our PDB-style files is described here.)

Timeline for d5o46a_: