Lineage for d5yg4a_ (5yg4 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505258Species Plasmodium vivax [TaxId:126793] [261543] (24 PDB entries)
  8. 2505286Domain d5yg4a_: 5yg4 A: [353400]
    automated match to d5xmqa_
    complexed with 8uf, cl, gol, plg

Details for d5yg4a_

PDB Entry: 5yg4 (more details), 2.3 Å

PDB Description: plasmodium vivax shmt bound with plp-glycine and s-gs849
PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d5yg4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yg4a_ c.67.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 126793]}
mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
gnaqlqqlkqevvtwagalpfp

SCOPe Domain Coordinates for d5yg4a_:

Click to download the PDB-style file with coordinates for d5yg4a_.
(The format of our PDB-style files is described here.)

Timeline for d5yg4a_: