Lineage for d5mgtd_ (5mgt D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608454Domain d5mgtd_: 5mgt D: [353364]
    Other proteins in same PDB: d5mgtc2
    automated match to d1xpha_
    complexed with cl, nag, so4

Details for d5mgtd_

PDB Entry: 5mgt (more details), 1.9 Å

PDB Description: complex of human nkr-p1 and llt1 in deglycosylated forms
PDB Compounds: (D:) Killer cell lectin-like receptor subfamily B member 1

SCOPe Domain Sequences for d5mgtd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mgtd_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdkai
lfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwic
qkelt

SCOPe Domain Coordinates for d5mgtd_:

Click to download the PDB-style file with coordinates for d5mgtd_.
(The format of our PDB-style files is described here.)

Timeline for d5mgtd_: