Lineage for d2napa2 (2nap A:4-600)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140578Protein Periplasmic nitrate reductase alpha chain [53717] (2 species)
  7. 2140579Species Desulfovibrio desulfuricans [TaxId:876] [53718] (5 PDB entries)
    dissimilatory nitrate reductase (NAP)
  8. 2140580Domain d2napa2: 2nap A:4-600 [35334]
    Other proteins in same PDB: d2napa1
    complexed with mes, mgd, mo, sf4

Details for d2napa2

PDB Entry: 2nap (more details), 1.9 Å

PDB Description: dissimilatory nitrate reductase (nap) from desulfovibrio desulfuricans
PDB Compounds: (A:) protein (periplasmic nitrate reductase)

SCOPe Domain Sequences for d2napa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2napa2 c.81.1.1 (A:4-600) Periplasmic nitrate reductase alpha chain {Desulfovibrio desulfuricans [TaxId: 876]}
rpekwvkgvcrycgtgcgvlvgvkdgkavaiqgnpnnhnagllclkgsllipvlnskerv
tqplvrrhkggklepvswdealdlmasrfrssidmygpnsvawygsgqclteesyvanki
fkggfgtnnvdgnprlcmasavggyvtsfgkdepmgtyadidqatcffiigsntseahpv
lfrriarrkqvepgvkiivadprrtntsriadmhvafrpgtdlafmhsmawviineeldn
prfwqryvnfmdaegkpsdfegykaflenyrpekvaeicrvpveqiygaarafaesaatm
slwcmginqrvqgvfannlihnlhlitgqicrpgatsfsltgqpnacggvrdggalshll
pagraipnakhraemeklwglpegriapepgyhtvalfealgrgdvkcmiicetnpahtl
pnlnkvhkamshpesfivcieafpdavtleyadlvlppafwcerdgvygcgerrysltek
avdppgqcrptvntlvefarragvdpqlvnfrnaedvwnewrmvskgttydfwgmtrerl
rkesgliwpcpsedhpgtslryvrgqdpcvpadhpdrfffygkpdgraviwmrpakg

SCOPe Domain Coordinates for d2napa2:

Click to download the PDB-style file with coordinates for d2napa2.
(The format of our PDB-style files is described here.)

Timeline for d2napa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2napa1