Lineage for d2napa1 (2nap A:601-723)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
Superfamily b.52.2: ADC-like [50692] (4 families) 
Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
molybdopterine enzyme
Protein Periplasmic nitrate reductase alpha chain, NapA [50706] (2 species) - Species Desulfovibrio desulfuricans [TaxId:876] [50707] (5 PDB entries)
dissimilatory nitrate reductase (NAP) 
Domain d2napa1: 2nap A:601-723 [26926]
Other proteins in same PDB: d2napa2
complexed with mes, mgd, mo, sf4
Details for d2napa1
PDB Entry: 2nap (more details), 1.9 Å
PDB Description: dissimilatory nitrate reductase (nap) from desulfovibrio desulfuricans
PDB Compounds: (A:) protein (periplasmic nitrate reductase)SCOPe Domain Sequences for d2napa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2napa1 b.52.2.2 (A:601-723) Periplasmic nitrate reductase alpha chain, NapA {Desulfovibrio desulfuricans [TaxId: 876]}
aaeepdaeyplyltsmrvidhwhtatmtgkvpelqkanpiafveineedaartgikhgds
vivetrrdamelparvsdvcrpgliavpffdpkklvnklfldatdpvsrepeykicaarv
rka
SCOPe Domain Coordinates for d2napa1:
Click to download the PDB-style file with coordinates for d2napa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2napa1:
- d2napa1 first appeared (with stable ids) in SCOP 1.55
- d2napa1 appears in SCOPe 2.07
View in 3D
