Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Bacillus pumilus [TaxId:1408] [353056] (4 PDB entries) |
Domain d5zqxa2: 5zqx A:324-534 [353137] Other proteins in same PDB: d5zqxa1, d5zqxa3, d5zqxb1, d5zqxc1, d5zqxc3, d5zqxd1 automated match to d3c2ub2 mutant |
PDB Entry: 5zqx (more details), 2 Å
SCOPe Domain Sequences for d5zqxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zqxa2 b.29.1.0 (A:324-534) automated matches {Bacillus pumilus [TaxId: 1408]} sptyhivdefkdsslnrhfqtlripftdqigsvtenphhlrlygqesltskftqafvarr wqsfyfeaetavsffpknfqqaaglvnyyntenwtalqvtyddalgrilelsvcenlafs qplikkiiipdeipyvylkvtvqretytysysfdqqewekidvplesthlsddfirgggf ftgafvgmqcqdtsgerlpadfkyfryeett
Timeline for d5zqxa2: