Lineage for d5zqxa2 (5zqx A:324-534)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780703Species Bacillus pumilus [TaxId:1408] [353056] (4 PDB entries)
  8. 2780706Domain d5zqxa2: 5zqx A:324-534 [353137]
    Other proteins in same PDB: d5zqxa1, d5zqxa3, d5zqxb1, d5zqxc1, d5zqxc3, d5zqxd1
    automated match to d3c2ub2
    mutant

Details for d5zqxa2

PDB Entry: 5zqx (more details), 2 Å

PDB Description: crystal structure of beta-xylosidase mutant (e186q) from bacillus pumilus
PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d5zqxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zqxa2 b.29.1.0 (A:324-534) automated matches {Bacillus pumilus [TaxId: 1408]}
sptyhivdefkdsslnrhfqtlripftdqigsvtenphhlrlygqesltskftqafvarr
wqsfyfeaetavsffpknfqqaaglvnyyntenwtalqvtyddalgrilelsvcenlafs
qplikkiiipdeipyvylkvtvqretytysysfdqqewekidvplesthlsddfirgggf
ftgafvgmqcqdtsgerlpadfkyfryeett

SCOPe Domain Coordinates for d5zqxa2:

Click to download the PDB-style file with coordinates for d5zqxa2.
(The format of our PDB-style files is described here.)

Timeline for d5zqxa2: