PDB entry 5zqx

View 5zqx on RCSB PDB site
Description: Crystal structure of beta-xylosidase mutant (E186Q) from Bacillus pumilus
Class: hydrolase
Keywords: xylobiose hydrolysis, HYDROLASE
Deposited on 2018-04-20, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-xylosidase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: xynB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07129 (0-534)
      • engineered mutation (185)
      • expression tag (535)
    Domains in SCOPe 2.07: d5zqxa1, d5zqxa2, d5zqxa3
  • Chain 'B':
    Compound: beta-xylosidase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: xynB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07129 (0-End)
      • engineered mutation (185)
    Domains in SCOPe 2.07: d5zqxb1, d5zqxb2
  • Chain 'C':
    Compound: beta-xylosidase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: xynB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07129 (0-534)
      • engineered mutation (185)
    Domains in SCOPe 2.07: d5zqxc1, d5zqxc2, d5zqxc3
  • Chain 'D':
    Compound: beta-xylosidase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: xynB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07129 (0-End)
      • engineered mutation (185)
    Domains in SCOPe 2.07: d5zqxd1, d5zqxd2
  • Heterogens: BXP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zqxA (A:)
    mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
    ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
    lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
    pikltqaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
    hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
    pyvvggkeglleveapamsvkefsptyhivdefkdsslnrhfqtlripftdqigsvtenp
    hhlrlygqesltskftqafvarrwqsfyfeaetavsffpknfqqaaglvnyyntenwtal
    qvtyddalgrilelsvcenlafsqplikkiiipdeipyvylkvtvqretytysysfdqqe
    wekidvplesthlsddfirgggfftgafvgmqcqdtsgerlpadfkyfryeettehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqxA (A:)
    mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
    ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
    lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
    pikltqaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
    hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
    pyvvggkeglleveapamsvkefsptyhivdefkdsslnrhfqtlripftdqigsvtenp
    hhlrlygqesltskftqafvarrwqsfyfeaetavsffpknfqqaaglvnyyntenwtal
    qvtyddalgrilelsvcenlafsqplikkiiipdeipyvylkvtvqretytysysfdqqe
    wekidvplesthlsddfirgggfftgafvgmqcqdtsgerlpadfkyfryeetteh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zqxB (B:)
    mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
    ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
    lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
    pikltqaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
    hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
    pyvvggkeglleveapamsvkefsptyhivdefkdsslnrhfqtlripftdqigsvtenp
    hhlrlygqesltskftqafvarrwqsfyfeaetavsffpknfqqaaglvnyyntenwtal
    qvtyddalgrilelsvcenlafsqplikkiiipdeipyvylkvtvqretytysysfdqqe
    wekidvplesthlsddfirgggfftgafvgmqcqdtsgerlpadfkyfryeettehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqxB (B:)
    mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
    ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
    lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
    pikltqaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
    hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
    pyvvggkeglleveapamsvkefsptyhivdefkdsslnrhfqtlripftdqigsvtenp
    hhlrlygqesltskftqafvarrwqsfyfeaetavsffpknfqqaaglvnyyntenwtal
    qvtyddalgrilelsvcenlafsqplikkiiipdeipyvylkvtvqretytysysfdqqe
    wekidvplesthlsddfirgggfftgafvgmqcqdtsgerlpadfkyfryeet
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zqxC (C:)
    mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
    ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
    lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
    pikltqaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
    hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
    pyvvggkeglleveapamsvkefsptyhivdefkdsslnrhfqtlripftdqigsvtenp
    hhlrlygqesltskftqafvarrwqsfyfeaetavsffpknfqqaaglvnyyntenwtal
    qvtyddalgrilelsvcenlafsqplikkiiipdeipyvylkvtvqretytysysfdqqe
    wekidvplesthlsddfirgggfftgafvgmqcqdtsgerlpadfkyfryeettehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqxC (C:)
    mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
    ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
    lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
    pikltqaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
    hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
    pyvvggkeglleveapamsvkefsptyhivdefkdsslnrhfqtlripftdqigsvtenp
    hhlrlygqesltskftqafvarrwqsfyfeaetavsffpknfqqaaglvnyyntenwtal
    qvtyddalgrilelsvcenlafsqplikkiiipdeipyvylkvtvqretytysysfdqqe
    wekidvplesthlsddfirgggfftgafvgmqcqdtsgerlpadfkyfryeette
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zqxD (D:)
    mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
    ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
    lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
    pikltqaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
    hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
    pyvvggkeglleveapamsvkefsptyhivdefkdsslnrhfqtlripftdqigsvtenp
    hhlrlygqesltskftqafvarrwqsfyfeaetavsffpknfqqaaglvnyyntenwtal
    qvtyddalgrilelsvcenlafsqplikkiiipdeipyvylkvtvqretytysysfdqqe
    wekidvplesthlsddfirgggfftgafvgmqcqdtsgerlpadfkyfryeettehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqxD (D:)
    mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
    ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
    lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
    pikltqaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
    hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
    pyvvggkeglleveapamsvkefsptyhivdefkdsslnrhfqtlripftdqigsvtenp
    hhlrlygqesltskftqafvarrwqsfyfeaetavsffpknfqqaaglvnyyntenwtal
    qvtyddalgrilelsvcenlafsqplikkiiipdeipyvylkvtvqretytysysfdqqe
    wekidvplesthlsddfirgggfftgafvgmqcqdtsgerlpadfkyfryeet