Class b: All beta proteins [48724] (180 folds) |
Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) |
Family b.67.2.0: automated matches [227228] (1 protein) not a true family |
Protein automated matches [226971] (7 species) not a true protein |
Species Bacillus pumilus [TaxId:1408] [353054] (4 PDB entries) |
Domain d5zqxa1: 5zqx A:1-323 [353136] Other proteins in same PDB: d5zqxa2, d5zqxa3, d5zqxb2, d5zqxc2, d5zqxc3, d5zqxd2 automated match to d3c2ua1 mutant |
PDB Entry: 5zqx (more details), 2 Å
SCOPe Domain Sequences for d5zqxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zqxa1 b.67.2.0 (A:1-323) automated matches {Bacillus pumilus [TaxId: 1408]} mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt pikltqaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw pyvvggkeglleveapamsvkef
Timeline for d5zqxa1: