Lineage for d5zqxa1 (5zqx A:1-323)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807321Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2807331Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2807514Family b.67.2.0: automated matches [227228] (1 protein)
    not a true family
  6. 2807515Protein automated matches [226971] (7 species)
    not a true protein
  7. 2807520Species Bacillus pumilus [TaxId:1408] [353054] (4 PDB entries)
  8. 2807523Domain d5zqxa1: 5zqx A:1-323 [353136]
    Other proteins in same PDB: d5zqxa2, d5zqxa3, d5zqxb2, d5zqxc2, d5zqxc3, d5zqxd2
    automated match to d3c2ua1
    mutant

Details for d5zqxa1

PDB Entry: 5zqx (more details), 2 Å

PDB Description: crystal structure of beta-xylosidase mutant (e186q) from bacillus pumilus
PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d5zqxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zqxa1 b.67.2.0 (A:1-323) automated matches {Bacillus pumilus [TaxId: 1408]}
mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
pikltqaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
pyvvggkeglleveapamsvkef

SCOPe Domain Coordinates for d5zqxa1:

Click to download the PDB-style file with coordinates for d5zqxa1.
(The format of our PDB-style files is described here.)

Timeline for d5zqxa1: