SCOPe 2.04: Domain d2pgia_: 2pgi A:

Lineage for d2pgia_ (2pgi A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 proteins)
   permutation of the double-SIS domain fold
   automatically mapped to Pfam PF00342

6. Protein Phosphoglucose isomerase, PGI [53702] (7 species)
   moonlights as neuroleukin, autocrine motility factor, and differentiation mediator

7. Species Bacillus stearothermophilus [TaxId:1422] [53704] (4 PDB entries)

8. Domain d2pgia_: 2pgi A: [35308]

Details for d2pgia_

PDB Entry: 2pgi, 2.3 Å

PDB Description: the crystal structure of phosphoglucose isomerase-an enzyme with autocrine motility factor activity in tumor cells

PDB Compounds: (A:) phosphoglucose isomerase

SCOPe Domain Sequences for d2pgia_:

Sequence; same for both SEQRES and ATOM records:

>d2pgia_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Bacillus stearothermophilus [TaxId: 1422]}
aisfdysnalpfmqeneldylsefvkaahhmlherkgpgsdflgwvdwpirydknefsri
kqaaerirnhsdalvvigiggsylgaraaiealshtfhnqmndttqiyfagqnisstyis
hlldvlegkdlsinvisksgtttepaiafrifrdymekkygkeearkriyvttdrtkgal
kkladqegyetfvipdniggrysvltavgllpiavaglnidrmmegaasayhkynnpdll
tnesyqyaavrnilyrkgkaiellvnyepslhyvsewwkqlfgesegkdqkglfpasvdf
ttdlhsmgqyvqegrrnlietvlhvkkpqieltiqedpenidglnflagktldevnkkaf
qgtllahvdggvpnliveldemneytfgemvyffekacgisghllgvnpfdqpgveaykk
nmfallgkpgfedekaalmkrl

Timeline for d2pgia_:

• d2pgia_ first appeared (with stable ids) in SCOP 1.55, called d2pgi__
  
• d2pgia_ appears in SCOPe 2.03
  
• d2pgia_ appears in SCOPe 2.05
  
• d2pgia_ appears in the current release, SCOPe 2.08