Lineage for d2pgia_ (2pgi A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1387552Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 1387553Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 1387601Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 proteins)
    permutation of the double-SIS domain fold
    automatically mapped to Pfam PF00342
  6. 1387602Protein Phosphoglucose isomerase, PGI [53702] (6 species)
    moonlights as neuroleukin, autocrine motility factor, and differentiation mediator
  7. 1387603Species Bacillus stearothermophilus [TaxId:1422] [53704] (4 PDB entries)
  8. 1387606Domain d2pgia_: 2pgi A: [35308]

Details for d2pgia_

PDB Entry: 2pgi (more details), 2.3 Å

PDB Description: the crystal structure of phosphoglucose isomerase-an enzyme with autocrine motility factor activity in tumor cells
PDB Compounds: (A:) phosphoglucose isomerase

SCOPe Domain Sequences for d2pgia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pgia_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Bacillus stearothermophilus [TaxId: 1422]}
aisfdysnalpfmqeneldylsefvkaahhmlherkgpgsdflgwvdwpirydknefsri
kqaaerirnhsdalvvigiggsylgaraaiealshtfhnqmndttqiyfagqnisstyis
hlldvlegkdlsinvisksgtttepaiafrifrdymekkygkeearkriyvttdrtkgal
kkladqegyetfvipdniggrysvltavgllpiavaglnidrmmegaasayhkynnpdll
tnesyqyaavrnilyrkgkaiellvnyepslhyvsewwkqlfgesegkdqkglfpasvdf
ttdlhsmgqyvqegrrnlietvlhvkkpqieltiqedpenidglnflagktldevnkkaf
qgtllahvdggvpnliveldemneytfgemvyffekacgisghllgvnpfdqpgveaykk
nmfallgkpgfedekaalmkrl

SCOPe Domain Coordinates for d2pgia_:

Click to download the PDB-style file with coordinates for d2pgia_.
(The format of our PDB-style files is described here.)

Timeline for d2pgia_: