SCOPe 2.08: Domain d6dgib2: 6dgi B:116-333

Lineage for d6dgib2 (6dgi B:116-333)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [352811] (1 PDB entry)

8. Domain d6dgib2: 6dgi B:116-333 [353071]
   Other proteins in same PDB: d6dgia1, d6dgia3, d6dgib1
   automated match to d5d8da2
   complexed with act, gol, mg

Details for d6dgib2

PDB Entry: 6dgi, 2.3 Å

PDB Description: the crystal structure of d-alanyl-alanine synthetase a from vibrio cholerae o1 biovar eltor str. n16961

PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d6dgib2:

Sequence, based on SEQRES records:

>d6dgib2 d.142.1.0 (B:116-333) automated matches {Vibrio cholerae [TaxId: 243277]}
nkitsklwydaldipntpylfltqntpssidkakqafghwgsifvkaarqgssvgcykvt
tedqiapaieaafgfseqvlveqavkprelevsayemngklyiskpgeviapegtfysye
ekysanshartvleaenltekhkeliqtyaervfihmklrhlsridffltqegqiylnev
ntfpgmtpismfpkmlehnghrfseflvqcvtntlvna

Sequence, based on observed residues (ATOM records):

>d6dgib2 d.142.1.0 (B:116-333) automated matches {Vibrio cholerae [TaxId: 243277]}
nkitsklwydaldipntpylfltqntpssidkakqafghwgsifvkaarqgssvgcykvt
tedqiapaieaafgfseqvlveqavkprelevsayemngklyiskpgeviapegtfysye
ekysrtvleaenltekhkeliqtyaervfihmklrhlsridffltqegqiylnevntfpg
mtpismfpkmlehnghrfseflvqcvtntlvna

Timeline for d6dgib2:

• d6dgib2 first appeared in SCOPe 2.07