Lineage for d6dgib2 (6dgi B:116-333)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979267Species Vibrio cholerae [TaxId:243277] [352811] (1 PDB entry)
  8. 2979269Domain d6dgib2: 6dgi B:116-333 [353071]
    Other proteins in same PDB: d6dgia1, d6dgia3, d6dgib1
    automated match to d5d8da2
    complexed with act, gol, mg

Details for d6dgib2

PDB Entry: 6dgi (more details), 2.3 Å

PDB Description: the crystal structure of d-alanyl-alanine synthetase a from vibrio cholerae o1 biovar eltor str. n16961
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d6dgib2:

Sequence, based on SEQRES records: (download)

>d6dgib2 d.142.1.0 (B:116-333) automated matches {Vibrio cholerae [TaxId: 243277]}
nkitsklwydaldipntpylfltqntpssidkakqafghwgsifvkaarqgssvgcykvt
tedqiapaieaafgfseqvlveqavkprelevsayemngklyiskpgeviapegtfysye
ekysanshartvleaenltekhkeliqtyaervfihmklrhlsridffltqegqiylnev
ntfpgmtpismfpkmlehnghrfseflvqcvtntlvna

Sequence, based on observed residues (ATOM records): (download)

>d6dgib2 d.142.1.0 (B:116-333) automated matches {Vibrio cholerae [TaxId: 243277]}
nkitsklwydaldipntpylfltqntpssidkakqafghwgsifvkaarqgssvgcykvt
tedqiapaieaafgfseqvlveqavkprelevsayemngklyiskpgeviapegtfysye
ekysrtvleaenltekhkeliqtyaervfihmklrhlsridffltqegqiylnevntfpg
mtpismfpkmlehnghrfseflvqcvtntlvna

SCOPe Domain Coordinates for d6dgib2:

Click to download the PDB-style file with coordinates for d6dgib2.
(The format of our PDB-style files is described here.)

Timeline for d6dgib2: