Lineage for d6dgia1 (6dgi A:1-115)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. Protein automated matches [226903] (40 species)
    not a true protein
  7. Species Vibrio cholerae [TaxId:243277] [352809] (1 PDB entry)
  8. Domain d6dgia1: 6dgi A:1-115 [352810]
    Other proteins in same PDB: d6dgia2, d6dgia3, d6dgib2
    automated match to d5d8da1
    complexed with act, gol, mg

Details for d6dgia1

PDB Entry: 6dgi (more details), 2.3 Å

PDB Description: the crystal structure of d-alanyl-alanine synthetase a from vibrio cholerae o1 biovar eltor str. n16961
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d6dgia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dgia1 c.30.1.0 (A:1-115) automated matches {Vibrio cholerae [TaxId: 243277]}
mtkttilllcgggsseheislvsanyiqqqleltpefhvirvemkkegwfseqgalvyld
tnsatlnsdkasypidfvvpcihgfpgetgdiqsmlelagipylgcgpeasansf

SCOPe Domain Coordinates for d6dgia1 are not available.

Timeline for d6dgia1:

Domains from same chain:
(mouse over for more information)
d6dgia2, d6dgia3
Domains from other chains:
(mouse over for more information)
d6dgib1, d6dgib2