| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
| Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
| Protein automated matches [226904] (39 species) not a true protein |
| Species Vibrio cholerae [TaxId:243277] [352811] (1 PDB entry) |
| Domain d6dgia2: 6dgi A:116-332 [352812] Other proteins in same PDB: d6dgia1, d6dgia3, d6dgib1 automated match to d5d8da2 complexed with act, gol, mg |
PDB Entry: 6dgi (more details), 2.3 Å
SCOPe Domain Sequences for d6dgia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dgia2 d.142.1.0 (A:116-332) automated matches {Vibrio cholerae [TaxId: 243277]}
nkitsklwydaldipntpylfltqntpssidkakqafghwgsifvkaarqgssvgcykvt
tedqiapaieaafgfseqvlveqavkprelevsayemngklyiskpgeviapegtfysye
ekysanshartvleaenltekhkeliqtyaervfihmklrhlsridffltqegqiylnev
ntfpgmtpismfpkmlehnghrfseflvqcvtntlvn
Timeline for d6dgia2: