Lineage for d1c7qa_ (1c7q A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515496Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2515497Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2515555Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 proteins)
    permutation of the double-SIS domain fold
    automatically mapped to Pfam PF00342
  6. 2515556Protein Phosphoglucose isomerase, PGI [53702] (8 species)
    moonlights as neuroleukin, autocrine motility factor, and differentiation mediator
  7. 2515557Species Bacillus stearothermophilus [TaxId:1422] [53704] (4 PDB entries)
  8. 2515558Domain d1c7qa_: 1c7q A: [35307]
    complexed with be1

Details for d1c7qa_

PDB Entry: 1c7q (more details), 2.3 Å

PDB Description: the crystal structure of phosphoglucose isomerase/autocrine motility factor/neuroleukin complexed with its carbohydrate phosphate inhibitors and its substrate recognition mechanism
PDB Compounds: (A:) phosphoglucose isomerase

SCOPe Domain Sequences for d1c7qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7qa_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Bacillus stearothermophilus [TaxId: 1422]}
aisfdysnalpfmqeneldylsefvkaahhmlherkgpgsdflgwvdwpirydknefsri
kqaaerirnhsdalvvigiggsylgaraaiealshtfhnqmndttqiyfagqnisstyis
hlldvlegkdlsinvisksgtttepaiafrifrdymekkygkeearkriyvttdrtkgal
kkladqegyetfvipdniggrysvltavgllpiavaglnidrmmegaasayhkynnpdll
tnesyqyaavrnilyrkgkaiellvnyepslhyvsewwkqlfgesegkdqkglfpasvdf
ttdlhsmgqyvqegrrnlietvlhvkkpqieltiqedpenidglnflagktldevnkkaf
qgtllahvdggvpnliveldemneytfgemvyffekacgisghllgvnpfdqpgveaykk
nmfallgkpgfedekaalmkrl

SCOPe Domain Coordinates for d1c7qa_:

Click to download the PDB-style file with coordinates for d1c7qa_.
(The format of our PDB-style files is described here.)

Timeline for d1c7qa_: