Lineage for d5w6ea_ (5w6e A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342214Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2342501Protein automated matches [190370] (2 species)
    not a true protein
  7. 2342502Species Human (Homo sapiens) [TaxId:9606] [187208] (34 PDB entries)
  8. 3052939Domain d5w6ea_: 5w6e A: [353001]
    automated match to d1taza_
    complexed with 0ny, mg, zn

Details for d5w6ea_

PDB Entry: 5w6e (more details), 1.9 Å

PDB Description: pde1b complexed with compound 3s
PDB Compounds: (A:) Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B

SCOPe Domain Sequences for d5w6ea_:

Sequence, based on SEQRES records: (download)

>d5w6ea_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfkiptvflmsfld
aletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiifaaaihdyehtg
ttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkdefvelralvie
mvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqwlvhsrwtkalm
eeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltdvaeksvqplad
edsksknqpsfqwrqpsldvevgdpnpdvvsfrstwvkriqenkqkwkeraas

Sequence, based on observed residues (ATOM records): (download)

>d5w6ea_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfkiptvflmsfld
aletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiifaaaihdyehtg
ttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkdefvelralvie
mvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqwlvhsrwtkalm
eeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltdvaeksvqvvsf
rstwvkriqenkqkwkeraas

SCOPe Domain Coordinates for d5w6ea_:

Click to download the PDB-style file with coordinates for d5w6ea_.
(The format of our PDB-style files is described here.)

Timeline for d5w6ea_:

  • d5w6ea_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-31