Lineage for d5oiza1 (5oiz A:71-263)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2610396Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 2610397Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 2610433Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 2610434Protein automated matches [226981] (13 species)
    not a true protein
  7. 2610521Species Streptococcus pneumoniae [TaxId:171101] [352952] (2 PDB entries)
  8. 2610522Domain d5oiza1: 5oiz A:71-263 [352979]
    Other proteins in same PDB: d5oiza2, d5oiza3, d5oiza4
    automated match to d1k25a3
    complexed with 1s6

Details for d5oiza1

PDB Entry: 5oiz (more details), 2.7 Å

PDB Description: penicillin-binding protein 2x (pbp2x) from streptococcus pneumoniae in complex with oxacillin
PDB Compounds: (A:) penicillin-binding protein 2x

SCOPe Domain Sequences for d5oiza1:

Sequence, based on SEQRES records: (download)

>d5oiza1 d.175.1.0 (A:71-263) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
tvpakrgtiydrngvpiaedatsynvyavidenyksatgkilyvektqfnkvaevfhkyl
dmeesyvreqlsqpnlkqvsfgakgngityanmmsikkeleaaevkgidfttspnrsypn
gqfassfiglaqlhenedgsksllgtsgmesslnsilagtdgiityekdrlgnivpgteq
vsqrtmdgkdvyt

Sequence, based on observed residues (ATOM records): (download)

>d5oiza1 d.175.1.0 (A:71-263) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
tvpakrgtiydrngvpiaedatsynvyavidyvektqfnkvaevfhkyldmeesyvreql
sqpnlkqvsfgakgngityanmmsikkeleaaevkgidfttspnrsypngqfassfigla
qlhenedgsksllgtsgmesslnsilagtdgvsqrtmdgkdvyt

SCOPe Domain Coordinates for d5oiza1:

Click to download the PDB-style file with coordinates for d5oiza1.
(The format of our PDB-style files is described here.)

Timeline for d5oiza1: