Lineage for d5oiza4 (5oiz A:693-750)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536656Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. 2536657Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (2 families) (S)
    duplication: consists of 2 subdomains of this fold
  5. 2536697Family d.11.1.0: automated matches [352956] (1 protein)
    not a true family
  6. 2536698Protein automated matches [352957] (2 species)
    not a true protein
  7. 2536704Species Streptococcus pneumoniae [TaxId:171101] [352958] (2 PDB entries)
  8. 2536706Domain d5oiza4: 5oiz A:693-750 [352982]
    Other proteins in same PDB: d5oiza1, d5oiza2
    automated match to d1k25a2
    complexed with 1s6

Details for d5oiza4

PDB Entry: 5oiz (more details), 2.7 Å

PDB Description: penicillin-binding protein 2x (pbp2x) from streptococcus pneumoniae in complex with oxacillin
PDB Compounds: (A:) penicillin-binding protein 2x

SCOPe Domain Sequences for d5oiza4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oiza4 d.11.1.0 (A:693-750) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
aeevpdmygwtketaetlakwlnielefqgsgstvqkqdvrantaikdikkitltlgd

SCOPe Domain Coordinates for d5oiza4:

Click to download the PDB-style file with coordinates for d5oiza4.
(The format of our PDB-style files is described here.)

Timeline for d5oiza4: