Lineage for d6cvmb2 (6cvm B:220-333)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763159Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries)
  8. 2763170Domain d6cvmb2: 6cvm B:220-333 [352931]
    Other proteins in same PDB: d6cvma1, d6cvma3, d6cvma5, d6cvmb1, d6cvmb3, d6cvmb5, d6cvmc1, d6cvmc3, d6cvmc5, d6cvmd1, d6cvmd3, d6cvmd5
    automated match to d1jz8a1
    complexed with mg, na, ptq

Details for d6cvmb2

PDB Entry: 6cvm (more details), 1.9 Å

PDB Description: atomic resolution cryo-em structure of beta-galactosidase
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d6cvmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cvmb2 b.1.4.0 (B:220-333) automated matches {Escherichia coli [TaxId: 83333]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d6cvmb2:

Click to download the PDB-style file with coordinates for d6cvmb2.
(The format of our PDB-style files is described here.)

Timeline for d6cvmb2: