Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries) |
Domain d6cvmd1: 6cvm D:2-219 [353143] Other proteins in same PDB: d6cvma2, d6cvma3, d6cvma4, d6cvma5, d6cvmb2, d6cvmb3, d6cvmb4, d6cvmb5, d6cvmc2, d6cvmc3, d6cvmc4, d6cvmc5, d6cvmd2, d6cvmd3, d6cvmd4, d6cvmd5 automated match to d1f4ha3 complexed with mg, na, ptq |
PDB Entry: 6cvm (more details), 1.9 Å
SCOPe Domain Sequences for d6cvmd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cvmd1 b.18.1.0 (D:2-219) automated matches {Escherichia coli [TaxId: 83333]} mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d6cvmd1:
View in 3D Domains from same chain: (mouse over for more information) d6cvmd2, d6cvmd3, d6cvmd4, d6cvmd5 |