Lineage for d6cvmc5 (6cvm C:731-1022)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2782125Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2782126Protein automated matches [226849] (8 species)
    not a true protein
  7. 2782209Species Escherichia coli [TaxId:83333] [272144] (6 PDB entries)
  8. 2782216Domain d6cvmc5: 6cvm C:731-1022 [352907]
    Other proteins in same PDB: d6cvma1, d6cvma2, d6cvma3, d6cvma4, d6cvmb1, d6cvmb2, d6cvmb3, d6cvmb4, d6cvmc1, d6cvmc2, d6cvmc3, d6cvmc4, d6cvmd1, d6cvmd2, d6cvmd3, d6cvmd4
    automated match to d1jz8a4
    complexed with mg, na, ptq

Details for d6cvmc5

PDB Entry: 6cvm (more details), 1.9 Å

PDB Description: atomic resolution cryo-em structure of beta-galactosidase
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d6cvmc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cvmc5 b.30.5.0 (C:731-1022) automated matches {Escherichia coli [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvvvasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq

SCOPe Domain Coordinates for d6cvmc5:

Click to download the PDB-style file with coordinates for d6cvmc5.
(The format of our PDB-style files is described here.)

Timeline for d6cvmc5: