Class b: All beta proteins [48724] (180 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
Protein automated matches [226849] (8 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272144] (6 PDB entries) |
Domain d6cvmc5: 6cvm C:731-1022 [352907] Other proteins in same PDB: d6cvma1, d6cvma2, d6cvma3, d6cvma4, d6cvmb1, d6cvmb2, d6cvmb3, d6cvmb4, d6cvmc1, d6cvmc2, d6cvmc3, d6cvmc4, d6cvmd1, d6cvmd2, d6cvmd3, d6cvmd4 automated match to d1jz8a4 complexed with mg, na, ptq |
PDB Entry: 6cvm (more details), 1.9 Å
SCOPe Domain Sequences for d6cvmc5:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cvmc5 b.30.5.0 (C:731-1022) automated matches {Escherichia coli [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvvvasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
Timeline for d6cvmc5:
View in 3D Domains from same chain: (mouse over for more information) d6cvmc1, d6cvmc2, d6cvmc3, d6cvmc4 |