SCOPe 2.07: Domain d6c97c2: 6c97 C:177-268

Lineage for d6c97c2 (6c97 C:177-268)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6c97c2: 6c97 C:177-268 [352783]
   Other proteins in same PDB: d6c97a1, d6c97b_, d6c97c1, d6c97d_
   automated match to d3frua1
   complexed with gol

Details for d6c97c2

PDB Entry: 6c97, 2 Å

PDB Description: crystal structure of fcrn at ph3

PDB Compounds: (C:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d6c97c2:

Sequence; same for both SEQRES and ATOM records:

>d6c97c2 b.1.1.0 (C:177-268) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvele

Timeline for d6c97c2:

• d6c97c2 is new in SCOPe 2.07-stable
  
• d6c97c2 appears in the current release, SCOPe 2.08