Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6c97c2: 6c97 C:177-268 [352783] Other proteins in same PDB: d6c97a1, d6c97b_, d6c97c1, d6c97d_ automated match to d3frua1 complexed with gol |
PDB Entry: 6c97 (more details), 2 Å
SCOPe Domain Sequences for d6c97c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c97c2 b.1.1.0 (C:177-268) automated matches {Human (Homo sapiens) [TaxId: 9606]} keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha sssltvksgdehhyccivqhaglaqplrvele
Timeline for d6c97c2:
View in 3D Domains from other chains: (mouse over for more information) d6c97a1, d6c97a2, d6c97b_, d6c97d_ |