Lineage for d6c97c2 (6c97 C:177-268)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755914Domain d6c97c2: 6c97 C:177-268 [352783]
    Other proteins in same PDB: d6c97a1, d6c97b_, d6c97c1, d6c97d_
    automated match to d3frua1
    complexed with gol

Details for d6c97c2

PDB Entry: 6c97 (more details), 2 Å

PDB Description: crystal structure of fcrn at ph3
PDB Compounds: (C:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d6c97c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c97c2 b.1.1.0 (C:177-268) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvele

SCOPe Domain Coordinates for d6c97c2:

Click to download the PDB-style file with coordinates for d6c97c2.
(The format of our PDB-style files is described here.)

Timeline for d6c97c2: