![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Japanese encephalitis virus (strain sa-14) [TaxId:11073] [352509] (2 PDB entries) |
![]() | Domain d5mv2a2: 5mv2 A:300-400 [352510] Other proteins in same PDB: d5mv2a1, d5mv2a3 automated match to d3p54a2 |
PDB Entry: 5mv2 (more details), 2.1 Å
SCOPe Domain Sequences for d5mv2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mv2a2 b.1.18.0 (A:300-400) automated matches {Japanese encephalitis virus (strain sa-14) [TaxId: 11073]} tygmctekfsfaknpvdtghgtvvielsysgsdgpckipivsvaslndmtpvgrlvtvnp fvatssanskvlvemeppfgdsyivvgrgdkqinhhwhkag
Timeline for d5mv2a2: