SCOPe 2.08: Domain d5mv2a2: 5mv2 A:300-400

Lineage for d5mv2a2 (5mv2 A:300-400)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Japanese encephalitis virus (strain sa-14) [TaxId:11073] [352509] (2 PDB entries)

8. Domain d5mv2a2: 5mv2 A:300-400 [352510]
   Other proteins in same PDB: d5mv2a1, d5mv2a3
   automated match to d3p54a2

Details for d5mv2a2

PDB Entry: 5mv2, 2.1 Å

PDB Description: crystal structure of the e protein of the japanese encephalitis live attenuated vaccine virus

PDB Compounds: (A:) E protein

SCOPe Domain Sequences for d5mv2a2:

Sequence; same for both SEQRES and ATOM records:

>d5mv2a2 b.1.18.0 (A:300-400) automated matches {Japanese encephalitis virus (strain sa-14) [TaxId: 11073]}
tygmctekfsfaknpvdtghgtvvielsysgsdgpckipivsvaslndmtpvgrlvtvnp
fvatssanskvlvemeppfgdsyivvgrgdkqinhhwhkag

Timeline for d5mv2a2:

• d5mv2a2 first appeared in SCOPe 2.07