SCOPe 2.08: Domain d5txib1: 5txi B:25-315

Lineage for d5txib1 (5txi B:25-315)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [189852] (11 PDB entries)

8. Domain d5txib1: 5txi B:25-315 [352211]
   Other proteins in same PDB: d5txia2, d5txib2
   automated match to d3huna1
   complexed with cl, gol, na, rb6, so4, zn

Details for d5txib1

PDB Entry: 5txi, 1.6 Å

PDB Description: crystal structure of wild-type s. aureus penicillin binding protein 4 (pbp4) in complex with ceftobiprole

PDB Compounds: (B:) penicillin binding protein 4

SCOPe Domain Sequences for d5txib1:

Sequence; same for both SEQRES and ATOM records:

>d5txib1 e.3.1.1 (B:25-315) automated matches {Staphylococcus aureus [TaxId: 1280]}
tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqy

Timeline for d5txib1:

• d5txib1 first appeared in SCOPe 2.07