SCOPe 2.08: Domain d5txib2: 5txi B:316-383

Lineage for d5txib2 (5txi B:316-383)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families)

5. Family b.105.1.0: automated matches [231757] (1 protein)
   not a true family

6. Protein automated matches [231758] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [352209] (2 PDB entries)

8. Domain d5txib2: 5txi B:316-383 [352212]
   Other proteins in same PDB: d5txia1, d5txib1
   automated match to d3huma2
   complexed with cl, gol, na, rb6, so4, zn

Details for d5txib2

PDB Entry: 5txi, 1.6 Å

PDB Description: crystal structure of wild-type s. aureus penicillin binding protein 4 (pbp4) in complex with ceftobiprole

PDB Compounds: (B:) penicillin binding protein 4

SCOPe Domain Sequences for d5txib2:

Sequence; same for both SEQRES and ATOM records:

>d5txib2 b.105.1.0 (B:316-383) automated matches {Staphylococcus aureus [TaxId: 1280]}
kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg
pptvevhq

Timeline for d5txib2:

• d5txib2 first appeared in SCOPe 2.07