Lineage for d5nt1b_ (5nt1 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616045Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 2616046Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 2616047Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 2616052Protein automated matches [190936] (7 species)
    not a true protein
  7. 2616091Species Influenza a virus (strain a/puerto rico/8/1934 h1n1) [TaxId:211044] [352181] (1 PDB entry)
  8. 2616092Domain d5nt1b_: 5nt1 B: [352182]
    automated match to d2gx9a1

Details for d5nt1b_

PDB Entry: 5nt1 (more details), 2.82 Å

PDB Description: complex of influenza a ns1 effector domain with trim25 coiled coil
PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d5nt1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nt1b_ d.299.1.1 (B:) automated matches {Influenza a virus (strain a/puerto rico/8/1934 h1n1) [TaxId: 211044]}
asryltdmtleemsrewsmlipkqkvagplcirmdqaimdkniilkanfsvifdrletli
llrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvsetlqrfawrs

SCOPe Domain Coordinates for d5nt1b_:

Click to download the PDB-style file with coordinates for d5nt1b_.
(The format of our PDB-style files is described here.)

Timeline for d5nt1b_: