SCOPe 2.07: Domain d6cdza_: 6cdz A:

Lineage for d6cdza_ (6cdz A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (71 PDB entries)

8. Domain d6cdza_: 6cdz A: [352049]
   automated match to d4iw5a_
   complexed with cb3, umc, ump; mutant

Details for d6cdza_

PDB Entry: 6cdz, 2.4 Å

PDB Description: e. coli thymidylate synthase mutant i264am

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d6cdza_:

Sequence; same for both SEQRES and ATOM records:

>d6cdza_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapva

Timeline for d6cdza_:

• d6cdza_ is new in SCOPe 2.07-stable
  
• d6cdza_ appears in the current release, SCOPe 2.08