Lineage for d5yoyi_ (5yoy I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743417Domain d5yoyi_: 5yoy I: [351997]
    Other proteins in same PDB: d5yoya1, d5yoya2, d5yoyb1, d5yoyb2, d5yoyc1, d5yoyc2, d5yoyd_, d5yoye_, d5yoyf_, d5yoyj1, d5yoyj2, d5yoyk1, d5yoyk2, d5yoyl1, d5yoyl2, d5yoym_, d5yoyn_, d5yoyo_
    automated match to d4kfzc_

Details for d5yoyi_

PDB Entry: 5yoy (more details), 2.73 Å

PDB Description: crystal structure of the human tumor necrosis factor in complex with golimumab fv
PDB Compounds: (I:) Golimumab heavy chain variable region

SCOPe Domain Sequences for d5yoyi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yoyi_ b.1.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvesgggvvqpgrslrlscaasgfifssyamhwvrqapgnglewvafmsydgsnkky
adsvkgrftisrdnskntlylqmnslraedtavyycardrgiaaggnyyyygmdvwgqgt
tvtvs

SCOPe Domain Coordinates for d5yoyi_:

Click to download the PDB-style file with coordinates for d5yoyi_.
(The format of our PDB-style files is described here.)

Timeline for d5yoyi_: