Lineage for d6ge9a2 (6ge9 A:264-479)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403213Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403214Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2403509Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2403510Protein automated matches [190967] (32 species)
    not a true protein
  7. 2403636Species Mycobacterium tuberculosis [TaxId:419947] [225671] (2 PDB entries)
  8. 3051604Domain d6ge9a2: 6ge9 A:264-479 [351666]
    Other proteins in same PDB: d6ge9a1
    automated match to d3d8va2
    complexed with aco, edo, g1p, mg, peg

Details for d6ge9a2

PDB Entry: 6ge9 (more details), 2.26 Å

PDB Description: structure of mycobacterium tuberculosis glmu bound to glc-1p and ac- coa
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d6ge9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ge9a2 b.81.1.0 (A:264-479) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr
thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi
geysnigassvfvnydgtskrrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvp
pgalavsagpqrnienwvqrkrpgspaaqaskrase

SCOPe Domain Coordinates for d6ge9a2:

Click to download the PDB-style file with coordinates for d6ge9a2.
(The format of our PDB-style files is described here.)

Timeline for d6ge9a2:

  • d6ge9a2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-03

View in 3D
Domains from same chain:
(mouse over for more information)
d6ge9a1