SCOPe 2.08: Domain d6ge9a2: 6ge9 A:264-479

Lineage for d6ge9a2 (6ge9 A:264-479)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (36 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:419947] [225671] (2 PDB entries)

8. Domain d6ge9a2: 6ge9 A:264-479 [351666]
   Other proteins in same PDB: d6ge9a1
   automated match to d3d8va2
   complexed with aco, edo, g1p, mg, peg

Details for d6ge9a2

PDB Entry: 6ge9, 2.26 Å

PDB Description: structure of mycobacterium tuberculosis glmu bound to glc-1p and ac- coa

PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d6ge9a2:

Sequence; same for both SEQRES and ATOM records:

>d6ge9a2 b.81.1.0 (A:264-479) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr
thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi
geysnigassvfvnydgtskrrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvp
pgalavsagpqrnienwvqrkrpgspaaqaskrase

Timeline for d6ge9a2:

• d6ge9a2 first appeared in SCOPe 2.07